PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00381.1.g00040.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 555aa    MW: 61263.7 Da    PI: 7.5862
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00381.1.g00040.1.sm.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.43.9e-214399157
                                    TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
                        Homeobox  1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                                    +++ +++t++q++eLe++F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k+
  Zpz_sc00381.1.g00040.1.sm.mkhc 43 KKRYHRHTQHQIQELEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMKN 99
                                    688999************************************************995 PP

2START155.64e-4929042574206
                                     TT-SEEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE- CS
                           START  74 etlakaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRa 145
                                     + + +a+tlev+s+g      galq+m+ e+q++splvp R+++fvRy++q ++g+w++vdvS+ds ++ +    v ++
  Zpz_sc00381.1.g00040.1.sm.mkhc 290 HIVSRAATLEVLSTGvagnynGALQVMSVEFQVPSPLVPtRESYFVRYCKQNSDGTWAVVDVSLDSLRPSS----VLKC 364
                                     67899***************************************************************965....8*** PP

                                     EESSEEEEEEEECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                           START 146 ellpSgiliepksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                                     +++pSg+li++++ng+sk+twvehv++++r++h +++ lv+sgla+ga++wv tl+rqce+
  Zpz_sc00381.1.g00040.1.sm.mkhc 365 RRRPSGCLIQEMPNGYSKITWVEHVEVDDRSVHDIYKLLVNSGLAFGARRWVGTLDRQCER 425
                                     ***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.94E-2127100IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.5E-232984IPR009057Homeodomain-like
PROSITE profilePS5007117.44340100IPR001356Homeobox domain
SMARTSM003892.6E-2041104IPR001356Homeobox domain
PfamPF000469.8E-194398IPR001356Homeobox domain
CDDcd000861.10E-1943101No hitNo description
PROSITE patternPS0002707598IPR017970Homeobox, conserved site
Gene3DG3DSA:1.10.10.605.0E-485127IPR009057Homeodomain-like
PROSITE profilePS5084831.44232428IPR002913START domain
SuperFamilySSF559612.29E-28233427No hitNo description
CDDcd088755.60E-98236424No hitNo description
SMARTSM002346.0E-37241425IPR002913START domain
PfamPF018525.7E-41290425IPR002913START domain
Gene3DG3DSA:3.30.530.201.0E-4307421IPR023393START-like domain
SuperFamilySSF559611.1E-8446531No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 555 aa     Download sequence    Send to blast
MYPTIRRNHG GKKGFASLLP LFENADGVSV DDLQDPSQPP NKKKRYHRHT QHQIQELEAF  60
FKECPHPDDK QRKELSRELG LEPLQVKFWF QNKRTQMKNQ HERQENSQLR AENEKLRAEN  120
MRYKEALSSA SCPNCGGPAA LGEMSFDEHH LRVENARLRE EIDRISAIAA KYVGKPMVSF  180
PVMSSPLAIT RAGASPLDLG VGAAYGAGAA NIFGGVAAGA GAGELLRGAL HSDADKPVIV  240
ELAVTAMEEL VRMAQVDEPL WNAPGLDGSA ETLNEEEYAR MFPQGLGPKH IVSRAATLEV  300
LSTGVAGNYN GALQVMSVEF QVPSPLVPTR ESYFVRYCKQ NSDGTWAVVD VSLDSLRPSS  360
VLKCRRRPSG CLIQEMPNGY SKITWVEHVE VDDRSVHDIY KLLVNSGLAF GARRWVGTLD  420
RQCERLASVM ASNIPTSDIG VITSTEGRKS MLKLAERMVI SFCGGVTASA AHQWTTLSGS  480
GAEDVRVMTR KSVDDPGRPP GIVLNAATSF WLPVPPKRVF DFLRDESSRS EASIRSPCML  540
MIECIHPYIH AHTRY
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0672590.0BT067259.1 Zea mays full-length cDNA clone ZM_BFb0357I11 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004976894.10.0PREDICTED: homeobox-leucine zipper protein ROC2
SwissprotQ0J9X20.0ROC2_ORYSJ; Homeobox-leucine zipper protein ROC2
TrEMBLK3Y5C10.0K3Y5C1_SETIT; Uncharacterized protein
STRINGSi009409m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79938147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21750.20.0HD-ZIP family protein